PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn082431
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family SBP
Protein Properties Length: 849aa    MW: 95142.3 Da    PI: 6.1902
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn082431genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP115.43.2e-36126202177
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                 +Cqv++Cead+se+k yhrrh+vC  +++a++++++g+++r+CqqC++fh ls+fDe+krsCrr+L++hn+rrr+k 
  Achn082431 126 RCQVPACEADISELKGYHRRHRVCLRCANATAIVLDGQKKRYCQQCGKFHILSDFDEGKRSCRRKLERHNNRRRRKP 202
                 6***********************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.6E-27122188IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.393124201IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.01E-33125204IPR004333Transcription factor, SBP-box
PfamPF031108.0E-27127201IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 849 aa     Download sequence    Send to blast
MDPPTPPPPP PLSDMENPIP HYDDPLWNWS DFLDFGIDAE AQFSISLDSD ASPPEQTPPP  60
PDPENLSRIR KRDPRMTCSN FLAGRIPCAC PELDAKIAEE EDEDGSMIPG KKRVRTARAV  120
AGTMVRCQVP ACEADISELK GYHRRHRVCL RCANATAIVL DGQKKRYCQQ CGKFHILSDF  180
DEGKRSCRRK LERHNNRRRR KPSESRVAVE REPQGPVLSD DVACHNENGK DSICLSNQIT  240
EREPLLESEG QIFTLCSNPG SENIQNNSVV SFVASGEAII VGEKDESKYA RSSNCEDKSA  300
YSSVCPTGRI SFKLYDWNPA EFPRRLRHQI FQWLASMPVE LEGYIRPGCT ILTLFIAMPK  360
SMWFKLLEDP VVYIHNIVAT PAKMLSGRGT VLVYLDNVIF RAMRVGTSVM QVKVEEQAPK  420
LHYVHPRCFE AGKPAEFVAC GSNLLQPKFR FLISFAGKYL ACDHCVPSLS GDTEGVTASF  480
DHQLLKIHIP HTEPDLFGPA FIEVDNESGL SNFIPILIGN KEICSEMKIM EHSFESSLCL  540
KGSEFMTTHS SSDACEVSIQ RQTALSQFIL DTAWLLRKPA LEDIEHILPS SQIGRFNRLL  600
TFLIHNKSTC ILERVIHYME NMMDNLNLNS LANSIVDTDM KLLQSNLDNA REILCHRLQE  660
KGDSAQDSGN LVQQGGCFNR CSQIDTLSAS FFDQDMEATE RGNLDAVAGQ NSQDQCVNLP  720
LLNREVVMSM NLVGERQRKS CNRLFTKKYL VSRPLIFLIA AAAVCFGIFL IIPFDKNSVN  780
TRNSDVDLAM LVEECLDSTF SCTHLALWDS FRRHSGGGGG GYDPNWFRRH SGGGGGYDPN  840
WSWLREKI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A2e-44122202181squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1187199RRKLERHNNRRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002277039.10.0PREDICTED: squamosa promoter-binding-like protein 7
RefseqXP_010649812.10.0PREDICTED: squamosa promoter-binding-like protein 7
SwissprotQ8S9G80.0SPL7_ARATH; Squamosa promoter-binding-like protein 7
TrEMBLF6HDJ00.0F6HDJ0_VITVI; Putative uncharacterized protein
STRINGVIT_05s0020g02160.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54072433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.30.0squamosa promoter binding protein-like 7